PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00078.1.g00470.1.sm.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family SBP
Protein Properties Length: 843aa    MW: 92562.8 Da    PI: 7.677
Description SBP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00078.1.g00470.1.sm.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SBP64.52.3e-20179224146
                                     --SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTT CS
                             SBP   1 lCqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqC 46 
                                     +Cqv++C+adl++ak+yhrrhkvCe+hsk++++lv++++qrfCqqC
  Zjn_sc00078.1.g00470.1.sm.mkhc 179 MCQVDDCRADLTSAKDYHRRHKVCETHSKTTKALVANQMQRFCQQC 224
                                     6********************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:4.10.1100.101.9E-22173225IPR004333Transcription factor, SBP-box
PROSITE profilePS5114116.204177254IPR004333Transcription factor, SBP-box
SuperFamilySSF1036121.83E-19178225IPR004333Transcription factor, SBP-box
PfamPF031101.1E-14180224IPR004333Transcription factor, SBP-box
CDDcd002042.95E-4631732No hitNo description
Gene3DG3DSA:1.25.40.207.7E-4634739IPR020683Ankyrin repeat-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042742Biological Processdefense response to bacterium
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005886Cellular Componentplasma membrane
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 843 aa     Download sequence    Send to blast
MQREVGPQVA PPLFLHQIQQ LPPHAAAAKK RGHPWPAVPP AKPAVVADAG AGGGNWNPRL  60
WDWDSRSLTA RPSPDALRLG SGAGQSQQQP PPPAARAAEA SRQGSGALNF QLGLREDGAT  120
AMDTTGPATV ASSPSPPRST AAGQEPVVRP SKRVRSGSPG SAGGSGGGGA ANGGGSYPMC  180
QVDDCRADLT SAKDYHRRHK VCETHSKTTK ALVANQMQRF CQQCIDEEVR HPQAADYGEG  240
TAVVEVSTSR AWCAPPLEVF KDSERLTENG SPPNPGYQSC YASTSCSDHS PSSSNSDEQD  300
RTGRIIFKLF GKEPSTIPGN LRSEIINWLK HSPTEMEGYI RPGCLVLSMY LSMPPIAWDD  360
LEENLLQRVN KLVQGSDVDF WRKGRFLVRT DTQLVAYKDG MTRLSKSWRT WNTPELTFVS  420
PIAVVGGKKA SLVLKGRNLT VPGTQIHCTN MGKYISKEVL CSAYPGTIYD DSGVETFDLP  480
GEPNLILGRC FIEVENRFRG NSFPVIVANP SVCQELRNLE VELEDSQLHD VCLDDQVHNR  540
RQSKARDQAL HFLNELGWLF QRAAAYTPST KSDVCDSDLI QFSIFRFKHL LLFSSERDWC  600
SLTRTLLDIL AKRSLVSEEL SQETLGMLSE IHLLNRAVKR KSNRMVHLLV QYVVICPDNS  660
KLYPFVPNLP GPGGLTPLHL AASIENAEDI VDALTDDPQQ IGLSCWQSVL DDDGQSPETY  720
AKLRNHNSYN ELVAQKQVDR KNNQVTIMVS KGEILVDQLG NDGDNKKSGT QALQITSCSQ  780
CAILESGVLR RPLRSRGLLA RPYIHSMLAI AAVCVCVCVF MRALLRFNSG RSFKWERLDF  840
GTI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj0_A2e-19175224150squamosa promoter-binding protein-like 12
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00155DAPTransfer from AT1G20980Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004973899.10.0PREDICTED: squamosa promoter-binding-like protein 15
RefseqXP_012702492.10.0PREDICTED: squamosa promoter-binding-like protein 15
SwissprotQ6Z8M80.0SPL15_ORYSJ; Squamosa promoter-binding-like protein 15
SwissprotA2YX040.0SPL15_ORYSI; Squamosa promoter-binding-like protein 15
TrEMBLK3YFY30.0K3YFY3_SETIT; Uncharacterized protein
STRINGSi013151m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP54563853
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G20980.11e-161squamosa promoter binding protein-like 14